The domain within your query sequence starts at position 41 and ends at position 81; the E-value for the TACI-CRD2 domain shown below is 9.6e-34.

INCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPR

TACI-CRD2

TACI-CRD2
PFAM accession number:PF09305
Interpro abstract (IPR015384):

Cytokines can be grouped into a family on the basis of sequence, functional and structural similarities [(PUBMED:8095800), (PUBMED:1377364), (PUBMED:15335677)]. Tumor necrosis factor (TNF) (also known as TNF-alpha or cachectin) is a monocyte-derived cytotoxin that has been implicated in tumour regression, septic shock and cachexia [(PUBMED:2989794), (PUBMED:3349526)]. The protein is synthesised as a prohormone with an unusually long and atypical signal sequence, which is absent from the mature secreted cytokine [(PUBMED:2268312)]. A short hydrophobic stretch of amino acids serves to anchor the prohormone in lipid bilayers [(PUBMED:2777790)]. Both the mature protein and a partially-processed form of the hormone are secreted after cleavage of the propeptide [(PUBMED:2777790)].

There are a number of different families of TNF, but all these cytokines seem to form homotrimeric (or heterotrimeric in the case of LT-alpha/beta) complexes that are recognised by their specific receptors.

This entry represents a cysteine-rich domain found in the TACI family of proteins. Members of this family are predominantly found in tumour necrosis factor receptor superfamily, member 13b (TACI), and are required for binding to the ligands APRIL and BAFF [(PUBMED:15542592)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TACI-CRD2