The domain within your query sequence starts at position 11 and ends at position 55; the E-value for the TAF domain shown below is 2.5e-22.

NTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDAL

TAF

 TAF
PFAM accession number:PF02969
Interpro abstract (IPR004823):

The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex. TFIID plays a central role in mediating promoter responses to various activators and repressors. It binds tightly to TAFII-250 and directly interacts with TAFII-40. TFIID is composed of TATA binding protein (TBP)and a number of TBP-associated factors (TAFS). TAF proteins adopt a histone-like fold.

GO process:DNA-templated transcription, initiation (GO:0006352)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TAF