The domain within your query sequence starts at position 9 and ends at position 291; the E-value for the TAF1_subA domain shown below is 1.6e-72.
LTKLAVAEDNPETSVLSKTGMHFPWLHKHVEAVVTGGKKRKDFAQTTSACLSFIQEALLK HQWQQAAEYMHSYLQTLEDSDTDKRQAAPEIIWKLGSEILFYHPKSNVETFNSFADRMKN IGVLNYLKISLQHALYLLHHGMLDDANRNLSKAETWRYGEKSSSQEVLINLVQAYKGLLQ YYTWTRKKMELSKLDEDDYAYAAKTRTMLSQSCKTSTNICALVKTPGVWDPFVKSYVEML EFYGDQDGAREMLTNYAYDEKFPSNPNAHVYLYEFLKREKAPR
TAF1_subA |
---|
PFAM accession number: | PF14929 |
---|---|
Interpro abstract (IPR039495): | TATA box binding protein associated factor RNA Polymerase I subunit A is found in eukaryotes and is encoded by the gene TAF1A in humans. Its function is to aid transcription of DNA into RNA by binding to the promoter at the -10 TATA box site. It is a component of the transcription factor SL1/TIF-IB complex, involved in PIC assembly (pre-initiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation depends on the rate of association of this protein. This protein also stabilises nucleolar transcription factor 1/UBTF on rDNA [ (PUBMED:7801123) ]. This entry also includes TAF1A homologues from plants. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TAF1_subA