The domain within your query sequence starts at position 9 and ends at position 296; the E-value for the TAF1_subA domain shown below is 8.4e-70.

LTKLAVAEDNPETSVLSKTGMHFPWLHKHVEAVVTGGKKRKDFAQTTSACLSFIQEALLK
HQWQQAAEYMHSYLQTLEDSDTDKRQAAPEIIWKLGSEILFYHPKSNVETFNSFADRMKN
IGVLNYLKWVFLLVQISLQHALYLLHHGMLDDANRNLSKAETWRYGEKSSSQEVLINLVQ
AYKGLLQYYTWTRKKMELSKLDEDDYAYAAKTRTMLSQSCKTSTNICALVKTPGVWDPFV
KSYVEMLEFYGDQDGAREMLTNYAYDEKFPSNPNAHVYLYEFLKREKA

TAF1_subA

TAF1_subA
PFAM accession number:PF14929
Interpro abstract (IPR039495):

TATA box binding protein associated factor RNA Polymerase I subunit A is found in eukaryotes and is encoded by the gene TAF1A in humans. Its function is to aid transcription of DNA into RNA by binding to the promoter at the -10 TATA box site. It is a component of the transcription factor SL1/TIF-IB complex, involved in PIC assembly (pre-initiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation depends on the rate of association of this protein. This protein also stabilises nucleolar transcription factor 1/UBTF on rDNA [ (PUBMED:7801123) ].

This entry also includes TAF1A homologues from plants.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TAF1_subA