The domain within your query sequence starts at position 249 and ends at position 338; the E-value for the TAF6_C domain shown below is 6.6e-22.

VLYCVLEPLAASINPLNDHWTLRDGAALLLSHIFWTHGDLVSGLYQQILLSLQKVLTDPV
RPLCSHYGAVVGLHALGWKAVERVLYPHLP

TAF6_C

TAF6_C
PFAM accession number:PF07571
Interpro abstract (IPR011442):

TAF6_C is the C-terminal domain of the TAF6 subunit of the general transcription factor TFIID. The crystal structure reveals the presence of five conserved HEAT repeats. This region is necessary for the complexing together of the subunits TAF5, TAF6 and TAF9 [(PUBMED:22696218)].

GO process:regulation of DNA binding transcription factor activity (GO:0051090)
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TAF6_C