The domain within your query sequence starts at position 308 and ends at position 397; the E-value for the TAF6_C domain shown below is 1.1e-33.
VMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRITKTFTKSWVDEK TPWTTRYGSIAGLAELGHDVIKTLILPRLQ
TAF6_C |
 |
|---|
| PFAM accession number: | PF07571 |
|---|---|
| Interpro abstract (IPR011442): | TAF6_C is the C-terminal domain of the TAF6 subunit of the general transcription factor TFIID. The crystal structure reveals the presence of five conserved HEAT repeats. This region is necessary for the complexing together of the subunits TAF5, TAF6 and TAF9 [ (PUBMED:22696218) ]. |
| GO process: | transcription initiation from RNA polymerase II promoter (GO:0006367) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TAF6_C