The domain within your query sequence starts at position 106 and ends at position 194; the E-value for the TAFII28 domain shown below is 1.7e-38.

MQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKVFVGEV
VEEALDVCEKWGETPPLQPKHMREAVRRL

TAFII28

TAFII28
PFAM accession number:PF04719
Interpro abstract (IPR006809):

The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex. The conserved region is found at the C terminus of most member proteins. The crystal structure of hTAFII28 with hTAFII18 shows that this region is involved in the binding of these two subunits. The conserved region contains four alpha helices and three loops arranged as in histone H3 [ (PUBMED:7729427) (PUBMED:9695952) ].

GO process:transcription initiation from RNA polymerase II promoter (GO:0006367)
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TAFII28