The domain within your query sequence starts at position 116 and ends at position 1351; the E-value for the TALPID3 domain shown below is < 1e-12.

NDIFISQYTMGQKDALRTVLKQKAQSMPVFKAVKVHLFEDTSTEKNTVAQETETPPNRID
SATTVAAATAAAIATAAPLIKVQSDLEAKVNCVGELLTKLQETDKQLQRVTEHQASVQSK
QEKVHCHDHDKQMNAFMEQHIRHLEKLQQQQIDIQTHFIDAALKASSLQLGMSTSRAVGK
YSGKLGSPSVGSSVFSHNTFVSKRVPLSEDTDFDGQKSPLETPAPRRFAPVPVSRDGKIT
KRESPTEEKENMEMNSPKGNVRLLEQVLNSNECLTRKTESSDITSLTQPKMGWNLEKRDS
TETLHSQIFPSSEERGTAQVPVPKYNDVVHDLGQKKQASDMLQIKQSPVTLRLSDHPHNP
ALLQTTNTRSVLKDAAKILRGVQNNKKVLEENLEAIVRAKDGAAMYSFINALATNREMSE
KIRIRKQVDEWIKIISAEIQDELMRKDYEQKRFDPKNQRNKKALTMSRDIKANNQEKTVN
RSVIPRSHYQKQTQEQFTSPPVRNLPASGPQKERSGLLKSATTLQDEDYMLQIYGKPVYQ
GHRSTLKKGPYLRFSSPSPKAKPQRPRVIELVKGTKVKSAKTQTDFHAASRMKMDSKIQH
PITALPHADQQYMVSPSREMPTVSGTLEGHLIPMAILLGQTQSNSDSMPPAGVTVNKPRP
VTVTTSIPPASRKGNAGVKKPNVAIVEMKSEKKDPPQLSVQILPSVDIDSVSYSSTDGAS
SPPSPKEASLPPLHTWIQTPDFMKVDEEEVPLPGTNFDEVIDVIQEEEKRDEIPECSAPM
LEFNRSVKVVPTKYNGPSFPPVVSAYHPTTDILDKVIERKETLENSLIQWVEQEIMSRII
SGLFPLQQQARLDASVSVSEASEPSASDIVAGTSSGALQRMVDARVPVNSDMVSHFVNEA
LTETIAVMLADREAERQRAAATSVPGDLSGTETNLLARVCAPVATPQPTPPCSPSPVREH
VRVKTPDSSPCESDPDAASSIKEIRVEKGSDMPAVMLVSTPTRTPVATPPPAAALTPTLS
ETSIDKLKLSSPELPKPWDSGDLPLDEENPNSLQELPHPRAVVMSVANEEPESVDFSAQP
APPEPAPSAPLPEGTKAPSLQRVPSSGSSTLENTLSTVTETETLDRHISEGEILFSCGQN
LATKRPGDLFLMNINDSLSSTLQDALEMEDDPPSEGQVIRRPHKKRHEDAIVALLTKQQR
ELLVSQQEEDLDNSVGELSEGQRLVLKAAEDISAGP

TALPID3

TALPID3
PFAM accession number:PF15324
Interpro abstract (IPR029246):

TALPID3 is the name of a classical chicken mutant with abnormal limb patterning and malformations in other regions of the embryo. It was so called because their paddle-shaped limbs resemble those of the mole (Talpa) [(PUBMED:16702409)]. Besides the limbs, there is a set of malformations including face, skeleton, and vascular defects [(PUBMED:16702409)]. TALPID3 gene was then identified and found to be a target for Hedgehog signalling [(PUBMED:11731473)]. In chickens, TALPID3 protein is a centrosomal protein required for the function of both Gli repressor and activator in the intracellular Hedgehog pathway [(PUBMED:16702409)]. Similar to the chicken TALPID3 mutants, the mouse mutants also lack primary cilia and have face and neural tube defects. Moreover, it has defects in left/right asymmetry [(PUBMED:21750036)].

GO process:smoothened signaling pathway (GO:0007224)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TALPID3