The domain within your query sequence starts at position 5 and ends at position 166; the E-value for the TAN domain shown below is 8.7e-34.
LNDLLICCRQLEHDRATERRKEVDKFKRLIQDPETVQHLDRHSDSKQGKYLNWDAVFRFL QKYIQKEMESLRTAKSNVSATTQSSRQKKMQEISSLVRYFIKCANKRAPRLKCQDLLNYV MDTVKDSSNGLTYGADCSNILLKDILSVRKYWCEVSQQQWLE
TAN |
![]() |
|---|
| PFAM accession number: | PF11640 |
|---|---|
| Interpro abstract (IPR021668): | ATM is a large protein kinase, in humans, critical for responding to DNA double-strand breaks (DSBs). Tel1, the orthologue from budding yeast, also regulates responses to DSBs. Tel1 is important for maintaining viability and for phosphorylation of the DNA damage signal transducer kinase Rad53 (an orthologue of mammalian CHK2). In addition to functioning in the response to DSBs, numerous findings indicate that Tel1/ATM regulates telomeres. The overall domain structure of Tel1/ATM is shared by proteins of the phosphatidylinositol 3-kinase (PI3K)-related kinase (PIKK) family, but this family carries a unique and functionally important TAN sequence motif, near its N-terminal, LxxxKxxE/DRxxxL. which is conserved specifically in the Tel1/ATM subclass of the PIKKs. The TAN motif is essential for both telomere length maintenance and Tel1 action in response to DNA damage [(PUBMED:18625723)]. It is classified as an EC 2.7.11.1. |
| GO function: | protein serine/threonine kinase activity (GO:0004674) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TAN
