The domain within your query sequence starts at position 8 and ends at position 298; the E-value for the TAS2R domain shown below is 7.4e-17.

VKTTEEVALQLLLLCQFGVGTVANVFLFVHNFYPVLTGSKQKPRQVILSHMAVANALTLF
LTIFPNNMMAFAPKTPPTELKCKLESFSHLVARSTNLCSNCVLGVHQFVTLVPLNRGKGK
LVLRASVTNMASYSSYSCWFFSVLSNIHIPIKVSGPQITDNNTDSKRKLFCSTSGFSVGI
VLLQFAYDATFMSIMVWTSVSMVLLLHRHRQRMQHILTPNQNPRGQAETRATRTILMLVV
TFVSFYLLNFICIMLHALFMHSHFFVRLVSEILTAVFPSISPLLLIFRDPK

TAS2R

TAS2R
PFAM accession number:PF05296
Interpro abstract (IPR007960):

This family consists of several forms of mammalian taste receptor proteins (TAS2Rs). TAS2Rs are G protein-coupled receptors expressed in subsets of taste receptor cells of the tongue and palate epithelia and are organised in the genome in clusters. The proteins are genetically linked to loci that influence bitter perception in mice and humans [(PUBMED:10761934)].

GO process:G-protein coupled receptor signaling pathway (GO:0007186), sensory perception of taste (GO:0050909)
GO component:integral component of membrane (GO:0016021)
GO function:G-protein coupled receptor activity (GO:0004930)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TAS2R