The domain within your query sequence starts at position 1 and ends at position 40; the E-value for the TAT_ubiq domain shown below is 2.2e-22.
MDSYVIQTNVNDSLPSVLDVRVNIGGRSSVQGRAKGRKAR
TAT_ubiq |
---|
PFAM accession number: | PF07706 |
---|---|
Interpro abstract (IPR011715): | This region contains a probable site of ubiquitination that ensures rapid degradation of tyrosine aminotransferase in rats. The half life of the enzyme in vivo is about 2-4 hours. The enzyme contains at least 2 phosphorylation sites including CAPK at Ser29 and, at the other end of the protein, a casein kinase II site at S*QEECDK. This region of TAT is probably primarily related to regulatory events. Most other transaminases are much more stable and are not phosphorylated. |
GO process: | aromatic amino acid family catabolic process (GO:0009074) |
GO function: | L-tyrosine:2-oxoglutarate aminotransferase activity (GO:0004838), pyridoxal phosphate binding (GO:0030170) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TAT_ubiq