The domain within your query sequence starts at position 261 and ends at position 400; the E-value for the TAXi_C domain shown below is 1.4e-8.

SWQITMKGVSVGSSTLLCEEGCAVVVDTGSSFISAPTSSLKLIMQALGAKEKRIEEYVVN
CSQVPTLPDISFDLGGRAYTLSSTDYVLQYPNRRDKLCTLALHAMDIPPPTGPVWVLGAT
FIRKFYTEFDRHNNRIGFAL

TAXi_C

TAXi_C
PFAM accession number:PF14541
Interpro abstract (IPR032799):

This entry represents a domain found C-terminal in some aspartic proteinases and in xylanase inhibitors. The N- and C-termini of xylanase inhibitor proteins are join to create the catalytic pocket necessary for cleaving xylanase. Phytopathogens produce xylanase that destroys plant cells, so its destruction through proteolysis is vital for plant-survival [(PUBMED:12681519), (PUBMED:15166216), (PUBMED:19769747)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TAXi_C