The domain within your query sequence starts at position 79 and ends at position 236; the E-value for the TAXi_N domain shown below is 1.3e-11.
YFGTISIGTPPQNFTVIFDTGSSNLWVPSVYCTSPACKAHPVFHPSQSDTYTEVGNHFSI QYGTGSLTGIIGADQVSVEGLTVDGQQFGESVKEPGQTFVNAEFDGILGLGYPSLAAGGV TPVFDNMMAQNLVALPMFSVYLSSDPQGGSGSELTFGG
TAXi_N |
---|
PFAM accession number: | PF14543 |
---|---|
Interpro abstract (IPR032861): | This entry represents a domain found N-terminal in some aspartic proteinases and in xylanase inhibitors. The N- and C-termini of xylanase inhibitor proteins are join to create the catalytic pocket necessary for cleaving xylanase. Phytopathogens produce xylanase that destroys plant cells, so its destruction through proteolysis is vital for plant-survival [ (PUBMED:12681519) (PUBMED:15166216) (PUBMED:19769747) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TAXi_N