The domain within your query sequence starts at position 7 and ends at position 95; the E-value for the TB2_DP1_HVA22 domain shown below is 2.1e-35.

SRAVVLVFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTLAWFPLYY
ELKIAFVIWLLSPYTRGASLIYRKFLHPL

TB2_DP1_HVA22

TB2_DP1_HVA22
PFAM accession number:PF03134
Interpro abstract (IPR004345):

This family includes members from a wide variety of eukaryotes. It includes the TB2/DP1 (deleted in polyposis) protein which in human is deleted in severe forms of familial adenomatous polyposis, an autosomal dominant oncological inherited disease.

The family also includes the plant protein of known similarity to TB2/DP1, the HVA22 abscisic acid-induced protein (e.g. Q07764), which is thought to be a regulatory protein.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TB2_DP1_HVA22