The domain within your query sequence starts at position 9 and ends at position 95; the E-value for the TBCA domain shown below is 8.4e-35.
IKIKTGVVRRLVKERVMYEKEAKQQEEKIEKMKAEDGENYAIKKQAEILQESRMMIPDCQ RRLEAAYTDLQQILESEKDLEEAEEYK
TBCA |
 |
|---|
| PFAM accession number: | PF02970 |
|---|---|
| Interpro abstract (IPR004226): | This entry represents tubulin binding cofactor A (TBCA) from animal, plants and fungi. Human TBCA functions as a molecular chaperone for beta-tubulin [ (PUBMED:12054808) ]. Budding yeast TBCA, also known as Rbl2, may bind transiently to free beta-tubulin, which then passes into an aggregated form that is not toxic [ (PUBMED:11739729) ]. The sequence identity of Rbl2 and human TBCA is only 32%, they appear to be structurally distinct and may interact with beta-tubulin by different mechanisms [ (PUBMED:15321725) ]. The tubulin heterodimer consists of one alpha- and one beta-tubulin polypeptide. In humans, five tubulin-specific chaperones termed TBCA/B/C/D/E are essential for bring the alpha- and beta-tubulin subunits together into a tightly associated heterodimer. Following the generation of quasi-native beta- and alpha-tubulin polypeptides (via multiple rounds of ATP-dependent interaction with the cytosolic chaperonin), TBCA and TBCB bind to and stabilise newly synthesised beta- and alpha-tubulin, respectively. The exchange of beta-tubulin between TBCA and TBCD, and of alpha-tubulin between TBCB and TBCE, resulting in the formation of TBCD/beta and TBCE/alpha. These two complexes then interact with each other and form a supercomplex (TBCE/alpha/TBCD/beta). Interaction of the supercomplex with TBCC causes the disassembly of the supercomplex and the release of E-site GDP-bound alpha/beta tubulin heterodimer, which becomes polymerization competent following spontaneous exchange with GTP [ (PUBMED:23973072) ]. |
| GO process: | tubulin complex assembly (GO:0007021), post-chaperonin tubulin folding pathway (GO:0007023) |
| GO function: | beta-tubulin binding (GO:0048487) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TBCA