The domain within your query sequence starts at position 129 and ends at position 185; the E-value for the TBD domain shown below is 1.3e-33.

PLHHERDNIEKTFWDLKEEFHRICLLAKAQKDHLSKLNIPDIATDTQCSVPIQCTDK

TBD

TBD
PFAM accession number:PF12845
Interpro abstract (IPR024581):

The Tbk1/Ikki binding domain (TBD) is a 40 amino acid domain able to bind kinases which is essential for poly(I:C)-induced IRF activation [(PUBMED:17568778)]. The domain is found in the SINTBAD, TANK and NAP1 proteins. This domain is predicted to form an alpha-helix with residues essential for kinase binding clustering on one side [(PUBMED:17568778)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TBD