The domain within your query sequence starts at position 173 and ends at position 255; the E-value for the TBP domain shown below is 1.2e-33.

VPQLQNVVSTANLACKLDLRKIALNAKNTEYNPKRFAAVIMRIREPRTTALIFSSGKVVC
TGAKSEEESRLAARKYARVVQKL

TBP

TBP
PFAM accession number:PF00352
Interpro abstract (IPR000814):

The TATA-box binding protein (TBP) is required for the initiation of transcription by RNA polymerases I, II and III, from promoters with or without a TATA box [(PUBMED:12782648), (PUBMED:10974559)]. TBP associates with a host of factors, including the general transcription factors SL1, TFIIA, -B, -D, -E, and -H, to form huge multi-subunit pre-initiation complexes on the core promoter. Through its association with different transcription factors, TBP can initiate transcription from different RNA polymerases. There are several related TBPs, including TBP-like (TBPL) proteins [(PUBMED:12878007)]. TBP binds directly to the TATA box promoter element, where it nucleates polymerase assembly, thus defining the transcription start site.

The C-terminal core of TBP (~180 residues) is highly conserved and contains two 77-amino acid repeats that produce a saddle-shaped structure that straddles the DNA; this region binds to the TATA box and interacts with transcription factors and regulatory proteins [(PUBMED:1436073)]. By contrast, the N-terminal region varies in both length and sequence.

GO process:DNA-templated transcription, initiation (GO:0006352)
GO function:DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TBP