The domain within your query sequence starts at position 22 and ends at position 87; the E-value for the TBP-binding domain shown below is 8.3e-28.
SDTDSDEESAGGGPFSLTGFLFGNINGAGQLEGESVLDDECKKHLAGLGALGLGSLITEL TANEEL
TBP-binding |
![]() |
---|
PFAM accession number: | PF09247 |
---|---|
Interpro abstract (IPR009067): | In eukaryotes, the general transcription factor TFIID helps to regulate transcription by RNA polymerase II from class II promoters. TFIID consists of TATA-box-binding proteins (TBP) and TBP-associated factors (TAFIIs), which together mediate both activation and inhibition of transcription. In Drosophila, the N-terminal region of TAFII-230 (the TFIID 230kDa subunit) binds directly to TBP, thereby inhibiting the binding of TBP to the TATA box. The N-terminal domain is comprised of three alpha helices and a beta hairpin, which forms the core that occupies the DNA-binding surface of TBP [ (PUBMED:9741622) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TBP-binding