The domain within your query sequence starts at position 11 and ends at position 83; the E-value for the TBPIP domain shown below is 6.2e-33.

GAPGIILRYLQEQNRPYSAQDVFGNLQKEHGLGKAAVVKALDQLAQEGKIKEKTYGKQKI
YFADQLYFSWLAE

TBPIP

TBPIP
PFAM accession number:PF07106
Interpro abstract (IPR010776):

This entry includes yeast homologous-pairing protein 2 (Hop2) and its homologues from animals and plants. They are required for proper homologous pairing and efficient cross-over and intragenic recombination during meiosis [(PUBMED:9708739), (PUBMED:11447128), (PUBMED:15192114)].

The mammalian HOP2 homologue, TBPIP, was first identified as a factor interacting with TBP-1, which binds to the human immunodeficiency virus, type 1 Tat protein [(PUBMED:9345291)]. Later, TBPIP was found to be an activator that specifically stimulates the homologous pairing catalyzed by DMC1 [(PUBMED:15192114)].

GO process:reciprocal meiotic recombination (GO:0007131)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TBPIP