The domain within your query sequence starts at position 323 and ends at position 411; the E-value for the TBX domain shown below is 8.8e-29.

RVFEERHKKETSDESSSEQAAFNCFAQASSPAVSIVGTSNLKDLCPSEAESDAEAESKEE
HGPEACDAAKISTTTAEEPGRDKGSPATR

TBX

TBX
PFAM accession number:PF12598
Interpro abstract (IPR022582):

This eukaryotic region of unknown function is typically between 77 and 89 amino acids in length. It is found C-terminal to the T-box DNA binding domain . This region contains two completely conserved residues (S and P) that may be functionally important. T-box genes are highly conserved and encode transcription factors that are involved in morphogenesis and organogenesis of both invertebrates and vertebrates [ (PUBMED:8597636) ],[ (PUBMED:8530034) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TBX