The domain within your query sequence starts at position 1 and ends at position 76; the E-value for the TC1 domain shown below is 2.3e-31.

MGTPASVVSEPPLWQVSTPQTRGRKQASANIFQDAELVQIQGLFQRSGDQLAEERAQIIW
ECAGDHRVAEALRRLR

TC1

TC1
PFAM accession number:PF15063
Interpro abstract (IPR020282):

This entry includes arginine vasopressin-induced protein 1 (Avpi1) and C8orf4 protein. Avpi1 is thought to be involved in MAP kinase activation, epithelial sodium channel (ENaC) down-regulation and cell cycling [(PUBMED:12356727)]. C8orf4, also known as transcriptional and immune response regulator (TCIM) or thyroid cancer 1 (TC-1), plays important roles in many signalling pathways, such as Wnt/beta-catenin signalling pathway, and is involved in the development of many cancers [(PUBMED:25869879)]. C8orf4 also suppresses NOTCH2 signalling in liver cancer stem cells [(PUBMED:25985737)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TC1