The domain within your query sequence starts at position 1 and ends at position 117; the E-value for the TCL1_MTCP1 domain shown below is 4.5e-37.

MAAAGFYPPRLLPQVLISTGPGFYEDEHHRLWMVAKLETCSHSPYCNKIETCVTVHLWQM
TRYPQEPAPYNPMNYNFLPMTWRLASMNTYRGTDAMHWRLLNHSQVGDTVQLILMLE

TCL1_MTCP1

TCL1_MTCP1
PFAM accession number:PF01840
Interpro abstract (IPR004832):

This entry represents MTCP1 and TCL1A/B from animals. They are encoded from a family of protooncogenes and function as Akt kinase coactivators [ (PUBMED:10983986) ]. TCL1 also acts as an NFkappaB activator, through the interaction with p300, and as an inhibitor of AP1-dependent transcription [ (PUBMED:19064921) ]. It affects both hair growth and epidermis integrity and is essential for mouse epidermal keratinocytes proliferation [ (PUBMED:30286151) ].

GO function:protein serine/threonine kinase activator activity (GO:0043539)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TCL1_MTCP1