The domain within your query sequence starts at position 1 and ends at position 66; the E-value for the TCRP1 domain shown below is 3.6e-21.

MNPVYSPGSSGVPYANAKGIGYPAGFPVGYAAAPAYSPNMYPGANPTFQTAELFHHTPLP
PILTRR

TCRP1

TCRP1
PFAM accession number:PF14944
Interpro abstract (IPR029247):

The FAM168 family consists of FAM168A and FAM168B. The function of FAM168A is unknown, but FAM168B has been renamed as myelin-associated neurite-outgrowth inhibitor (MANI), as it is an inhibitor of neuronal axonal outgrowth [ (PUBMED:20716133) ]. MANI interacts with cell division cycle protein 27 (Cdc27) [ (PUBMED:22771904) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TCRP1