The domain within your query sequence starts at position 54 and ends at position 206; the E-value for the TCRP1 domain shown below is 1.1e-89.

IEPRVLHMLGYTPGTPYKVSCSPTSGAVPPYSSSPNPYQTAVYPVRSAYPQQSPYAQQGT
YYTQPLYAAPPHVIHHTTVVQPNGMPATVYPAPIPPPRGSGVTMGMVAGTTMAMSAGTLL
TAHSPTPVAPHPVTVPTYRAPGTPTYSYVPPQW

TCRP1

TCRP1
PFAM accession number:PF14944
Interpro abstract (IPR029247): The FAM168 family consists of FAM168A and FAM168B. The function of FAM168A is unknown, but FAM168B has been renamed as myelin-associated neurite-outgrowth inhibitor (MANI), as it is an inhibitor of neuronal axonal outgrowth [(PUBMED:20716133)]. MANI interacts with cell division cycle protein 27 (Cdc27) [(PUBMED:22771904)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TCRP1