The domain within your query sequence starts at position 2 and ends at position 55; the E-value for the TEA domain shown below is 1.1e-18.
TSNEWSSPDSPEGSSISGGSQALDKPIDNDAEGVWSPEIERSFQEALAIYPPC
TEA |
---|
PFAM accession number: | PF01285 |
---|---|
Interpro abstract (IPR000818): | The TEA domain is a DNA-binding region of about 66 to 68 amino acids that has been named after the two proteins that originally defined the domain: TEF-1 and abaA. The TEA domain is located toward the amino terminus of eukaryotic transcription factors of the TEA/ATTS family. It is predicted to contain three alpha-helices, two of which have been demonstrated to be important for DNA binding [ (PUBMED:8389695) ]. |
GO process: | regulation of transcription, DNA-templated (GO:0006355) |
GO function: | DNA-binding transcription factor activity (GO:0003700) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TEA