The domain within your query sequence starts at position 320 and ends at position 360; the E-value for the TERF2_RBM domain shown below is 5.1e-22.

PQNPPATIGIRTLKAAFKALSTAQDSEAAFAKLDQKDLVLA

TERF2_RBM

 TERF2_RBM
PFAM accession number:PF16772
Interpro abstract (IPR031902):

This domain, found in mammalian telomeric repeat-binding factor 2 (TERF2, also known as TRF2) and fission yeast Taz1, binds to the C terminus of repressor activator protein 1 (RAP1) (telomeric repeat-binding factor 2-interacting protein 1) [ (PUBMED:21217703) ]. Through this interaction, RAP1 is targeted to chromosome ends for telomere protection [ (PUBMED:21217703) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TERF2_RBM