The domain within your query sequence starts at position 28 and ends at position 122; the E-value for the TEX12 domain shown below is 2e-54.
PQVSSLGKSESSLSEASGLFYKEEALEKDLSDMSKEINLMLSTYAKILSERAAVDASYID EIDGLFKEANIIENFLVQKREFLKQRFTVITNTLH
TEX12 |
---|
PFAM accession number: | PF15219 |
---|---|
Interpro abstract (IPR029193): | TEX12 is a meiosis-specific protein [ (PUBMED:16968740) ]. TEX12 contributes to the formation of the central element of the synaptonemal complex (SC) in mouse meiocytes [ (PUBMED:22164254) (PUBMED:21637789) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TEX12