The domain within your query sequence starts at position 4 and ends at position 151; the E-value for the TEX13 domain shown below is 9.3e-64.

DWGDHSTGFRHSEVIRFINNEILMNGGGPEFYLAFRMRPWNEIEDQLRAILIDPQVPRSL
KRACTWSALALGVRIAARQREQQAYMVGLSQDAFGQLPSAPRASVSELWQLRQQREEAVT
QLISTQAALQQAMRECDLLRRRLHHVER

TEX13

TEX13
PFAM accession number:PF15186
Interpro abstract (IPR028193):

The function of this family of proteins has not, as yet, been determined. However, members are thought to be encoded for by spermatogonially-expressed, germ-cell-specific genes [ (PUBMED:14531651) ]. This family of proteins is found in eukaryotes. Proteins in this family are typically between 177 and 384 amino acids in length. There are two conserved sequence motifs: FIN and LAL.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TEX13