The domain within your query sequence starts at position 103 and ends at position 241; the E-value for the TEX33 domain shown below is 9.6e-73.

SVIPENIRHKFGSKMVDQLISEDQARQAIGEMFEGQKRPSSWPSRTQSPMQASSIFSDYY
DLGYHMRSNLFQGPPQETKSLMKASYTPEVIEKSVRDVEHWHGRKTDDLGRWHRKNAMNM
NLQKALEEKYGEKSRSKAK

TEX33

• PFAM accession number: PF15400
• Interpro abstract (IPR029234):

  This entry represents a group of eukaryotic proteins that are typically between 147 and 280 amino acids in length. There are two conserved sequence motifs: NIRH and SYT. Their function is not known.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TEX33