The domain within your query sequence starts at position 900 and ends at position 1090; the E-value for the TFCD_C domain shown below is 1.4e-74.
HICERVMCCVAQQASEKIDRFRAHAARVFLTLLHFDSPPIPHVPHRQELESLFPRSDVAT VNWNAPSQAFPLITQLLGLPTYRYHVLLGLAVSVGGLTESTVRHSTQSLFEYMKGIQKDA QVLQSFSETLLKVFEDNLLNDRVSVSLLKMLDQLLANGCFDIFTAEENHPFCVKLLTLCK EEIKKSKDIQK
TFCD_C |
---|
PFAM accession number: | PF12612 |
---|---|
Interpro abstract (IPR022577): | This region is found in eukaryotes, and is typically between 182 and 199 amino acids in length. There is a single completely conserved residue R that may be functionally important. Tubulin folding cofactor D does not co-polymerise with microtubules either in vivo or in vitro, but instead modulates microtubule dynamics by sequestering beta-tubulin from GTP-bound alphabeta-heterodimers in microtubules [ (PUBMED:10722852) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TFCD_C