The domain within your query sequence starts at position 51 and ends at position 91; the E-value for the TFIIA_gamma_C domain shown below is 4.4e-20.
RVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVD
TFIIA_gamma_C |
---|
PFAM accession number: | PF02751 |
---|---|
Interpro abstract (IPR015871): | Transcription factor IIA (TFIIA) is one of several factors that form part of a transcription pre-initiation complex along with RNA polymerase II, the TATA-box-binding protein (TBP) and TBP-associated factors, on the TATA-box sequence upstream of the initiation start site. After initiation, some components of the pre-initiation complex (including TFIIA) remain attached and re-initiate a subsequent round of transcription. TFIIA binds to TBP to stabilise TBP binding to the TATA element. TFIIA also inhibits the cytokine HMGB1 (high mobility group 1 protein) binding to TBP [ (PUBMED:12818428) ], and can dissociate HMGB1 already bound to TBP/TATA-box. Human and Drosophila TFIIA have three subunits: two large subunits, LN/alpha and LC/beta, derived from the same gene, and a small subunit, S/gamma. Yeast TFIIA has two subunits: a large TOA1 subunit that shows sequence similarity to the N-terminal of LN/alpha and the C-terminal of LC/beta, and a small subunit, TOA2 that is highly homologous with S/gamma. The conserved regions of the large and small subunits of TFIIA combine to form two domains: a four-helix bundle (helical domain) composed of two helices from each of the N-terminal regions of TOA1 and TOA2 in yeast; and a beta-barrel (beta-barrel domain) composed of beta-sheets from the C-terminal regions of TOA1 and TOA2 [ (PUBMED:8610010) ]. This entry represents the beta-barrel domain found at the C-terminal of the gamma subunit of transcription factor TFIIA. |
GO process: | transcription initiation from RNA polymerase II promoter (GO:0006367) |
GO component: | transcription factor TFIIA complex (GO:0005672) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TFIIA_gamma_C