The domain within your query sequence starts at position 1 and ends at position 49; the E-value for the TFIIA_gamma_N domain shown below is 2e-28.

MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALA

TFIIA_gamma_N

TFIIA_gamma_N
PFAM accession number:PF02268
Interpro abstract (IPR015872):

Transcription factor IIA (TFIIA) is one of several factors that form part of a transcription pre-initiation complex along with RNA polymerase II, the TATA-box-binding protein (TBP) and TBP-associated factors, on the TATA-box sequence upstream of the initiation start site. After initiation, some components of the pre-initiation complex (including TFIIA) remain attached and re-initiate a subsequent round of transcription. TFIIA binds to TBP to stabilise TBP binding to the TATA element. TFIIA also inhibits the cytokine HMGB1 (high mobility group 1 protein) binding to TBP [ (PUBMED:12818428) ], and can dissociate HMGB1 already bound to TBP/TATA-box.

Human and Drosophila TFIIA have three subunits: two large subunits, LN/alpha and LC/beta, derived from the same gene, and a small subunit, S/gamma. Yeast TFIIA has two subunits: a large TOA1 subunit that shows sequence similarity to the N-terminal of LN/alpha and the C-terminal of LC/beta, and a small subunit, TOA2 that is highly homologous with S/gamma. The conserved regions of the large and small subunits of TFIIA combine to form two domains: a four-helix bundle (helical domain) composed of two helices from each of the N-terminal regions of TOA1 and TOA2 in yeast; and a beta-barrel (beta-barrel domain) composed of beta-sheets from the C-terminal regions of TOA1 and TOA2 [ (PUBMED:8610010) ].

This entry represents the alpha-helical domain found at the N-terminal of the gamma subunit of transcription factor TFIIA.

GO process:transcription initiation from RNA polymerase II promoter (GO:0006367)
GO component:transcription factor TFIIA complex (GO:0005672)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TFIIA_gamma_N