The domain within your query sequence starts at position 128 and ends at position 177; the E-value for the TFIID_30kDa domain shown below is 6.1e-30.
PTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMK
TFIID_30kDa |
---|
PFAM accession number: | PF03540 |
---|---|
Interpro abstract (IPR003923): | Transcription initiation factor TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. The complex includes TATA binding protein (TBP) and various TBP-associated factors (TAFS). TFIID is a bona fide RNA polymerase II-specific TATA-binding protein-associated factor (TAF) and is essential for viability [ (PUBMED:8662725) ]. This entry represents one of the TAFs, TAF10. TFIID acts to nucleate the transcription complex, recruiting the rest of the factors through a direct interaction with TFIIB. The TBP subunit of TFIID is sufficient for TATA-element binding and TFIIB interaction, and can support basal transcription. The protein belongs to the TAF2H family. TAF10 is part of other transcription regulatory multiprotein complexes (e.g., SAGA, TBP-free TAF-containing complex [TFTC], STAGA, and PCAF/GCN5). Several TAFs interact via histone-fold motifs. The histone fold (HFD) is the interaction motif involved in heterodimerization of the core histones and their assembly into nucleosome octamer. The minimal HFD contains three alpha-helices linked by two loops. The HFD is found in core histones, TAFs and many other transcription factors. Five HF-containing TAF pairs have been described in TFIID: TAF6-TAF9, TAF4-TAF12, TAF11-TAF13, TAF8-TAF10 and TAF3-TAF10 [ (PUBMED:16858867) (PUBMED:15870280) (PUBMED:17375202) ]. |
GO process: | DNA-templated transcription, initiation (GO:0006352) |
GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TFIID_30kDa