The domain within your query sequence starts at position 7 and ends at position 105; the E-value for the TFIIF_beta domain shown below is 6.7e-19.

LDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKNQGRTEVSFTLNEDLANIH
DIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLS

TFIIF_beta

TFIIF_beta
PFAM accession number:PF02270
Interpro abstract (IPR003196): Accurate transcription in vivo requires at least six general transcription initiation factors, in addition to RNA polymerase II. Transcription initiation factor IIF (TFIIF) is a tetramer consisting of two large subunits (TFIIF alpha or RAP74) and two small subunits (TFIIF beta or RAP30) [(PUBMED:7596813)]. The beta subunit of TFIIF is required for recruitment of RNA polymerase II onto the promoter.
GO process:transcription initiation from RNA polymerase II promoter (GO:0006367), transcription by RNA polymerase II (GO:0006366)
GO component:transcription factor TFIIF complex (GO:0005674)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TFIIF_beta