SMART: Pfam domain TFIIF

The domain within your query sequence starts at position 99 and ends at position 240; the E-value for the TFIIF_beta domain shown below is 1e-44.

SSSDKLSLEGIVVQRAECRPAASENYMKLKRLQIEESSKPVRLSQQLDKVVTTNYKPVAN
HQYNIEYERKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVGYLKEILK
EIGIQNVKGIHKNTWELKPEYR

TFIIF_beta

PFAM accession number:	PF02270
Interpro abstract (IPR040450):	Accurate transcription in vivo requires at least six general transcription initiation factors, in addition to RNA polymerase II. Transcription initiation factor IIF (TFIIF) is a tetramer consisting of two large subunits (TFIIF alpha or RAP74) and two small subunits (TFIIF beta or RAP30) [ (PUBMED:7596813) ]. The beta subunit of TFIIF is required for recruitment of RNA polymerase II onto the promoter.

PFAM accession number:

PF02270

Interpro abstract (IPR040450):

Accurate transcription in vivo requires at least six general transcription initiation factors, in addition to RNA polymerase II. Transcription initiation factor IIF (TFIIF) is a tetramer consisting of two large subunits (TFIIF alpha or RAP74) and two small subunits (TFIIF beta or RAP30) [ (PUBMED:7596813) ]. The beta subunit of TFIIF is required for recruitment of RNA polymerase II onto the promoter.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TFIIF_beta