The domain within your query sequence starts at position 59 and ends at position 250; the E-value for the TFIIIC_delta domain shown below is 1.1e-45.
AVSGLEPLSWSEDHRVSVSTARSVAVLELICDVHNPGQDLVIHRTSVPAPLNSCLLKVGS KTEVAECKEKFASSKDPTISQTFMLDRMFNPEGKALPPMRGFKYTSWSPMGCDANGRCLL AALTMDNRLTVQVNLNRLQWVQLVDLTEIYGDRLYETSYRLSKNEAPEGNLGDFAEFQRR HSMQTPVRMEWS
TFIIIC_delta |
---|
PFAM accession number: | PF12657 |
---|---|
Interpro abstract (IPR024761): | This entry represents a domain found towards the N terminus of the 90kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast [ (PUBMED:10523658) ]). The whole subunit is involved in RNA polymerase III-mediated transcription. It is possible that this N-terminal domain interacts with TFIIIC subunit 8 [ (PUBMED:11433012) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TFIIIC_delta