The domain within your query sequence starts at position 59 and ends at position 250; the E-value for the TFIIIC_delta domain shown below is 1.1e-45.

AVSGLEPLSWSEDHRVSVSTARSVAVLELICDVHNPGQDLVIHRTSVPAPLNSCLLKVGS
KTEVAECKEKFASSKDPTISQTFMLDRMFNPEGKALPPMRGFKYTSWSPMGCDANGRCLL
AALTMDNRLTVQVNLNRLQWVQLVDLTEIYGDRLYETSYRLSKNEAPEGNLGDFAEFQRR
HSMQTPVRMEWS

TFIIIC_delta

TFIIIC_delta
PFAM accession number:PF12657
Interpro abstract (IPR024761):

This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast [(PUBMED:10523658)]). The whole subunit is involved in RNA polymerase III-mediated transcription. It is possible that this N-terminal domain interacts with TFIIIC subunit 8 [(PUBMED:11433012)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TFIIIC_delta