The domain within your query sequence starts at position 51 and ends at position 84; the E-value for the TFIIIC_sub6 domain shown below is 7e-19.
KCKILGIDTERPIMQVDSYVFAGEYEDTLGTCVI
TFIIIC_sub6 |
---|
PFAM accession number: | PF10419 |
---|---|
Interpro abstract (IPR019481): | This conserved domain is found in a family of proteins that function as subunits of transcription factor IIIC (TFIIIC) [ (PUBMED:17409385) ]. TFIIIC in yeast and humans is required for transcription of tRNA and 5 S RNA genes by RNA polymerase III. The yeast proteins in this entry are fused to phosphoglycerate mutase domain. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TFIIIC_sub6