The domain within your query sequence starts at position 616 and ends at position 739; the E-value for the TFR_dimer domain shown below is 3.8e-42.
AVSFDPLFSAVKNFSEAASDFHRRLTQVDLNNPIAVRIMNDQQMLLERAFIDPLGLPGRK FYRHIIFAPSSHNKYAGESFPGIYDAMFDIENKADPSLAWAEVKKHISIAAFTIQAAAGT LTNV
TFR_dimer |
---|
PFAM accession number: | PF04253 |
---|---|
Interpro abstract (IPR007365): | This entry represents the dimerisation domain found in the transferrin receptor, as well as in a number of other proteins including glutamate carboxypeptidase II and N-acetylated-alpha-linked acidic dipeptidase like protein. The transferrin receptor (TfR) assists iron uptake into vertebrate cells through a cycle of endo- and exocytosis of the iron transport protein transferrin (Tf). TfR binds iron-loaded (diferric) Tf at the cell surface and carries it to the endosome, where the iron dissociates from Tf. The apo-Tf remains bound to TfR until it reaches the cell surface, where apo-Tf is replaced by diferric Tf from the serum to begin the cycle again. Human TfR is a homodimeric type II transmembrane protein. The crystal structure of a TfR monomer reveals a 3-domain structure: a protease-like domain that closely resembles carboxy- and amino-peptidases; an apical domain consisting of a beta-sandwich; and a helical dimerisation domain. The dimerisation domain consists of a 4-helical bundle that makes contact with each of the three domains in the dimer partner [ (PUBMED:10531064) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TFR_dimer