The domain within your query sequence starts at position 178 and ends at position 279; the E-value for the TF_Otx domain shown below is 2.5e-39.
SPASISPGSAPTSVSVPEPLAAPSNASCMQRSVAAGAATAAASYPMSYGQGGSYGQGYPA PSSSYFGGVDCSSYLAPMHSHHHPHQLSPMAPSSMAGHHHHH
TF_Otx |
---|
PFAM accession number: | PF03529 |
---|---|
Interpro abstract (IPR013851): | Otx proteins constitute a class of vertebrate homeodomain-containing transcription factors that have been shown to be essential for anterior head formation, including brain morphogenesis. They are orthologous to the product of the Drosophila head gap gene, orthodenticle (Otd), and appear to play similar roles in both, since the developmental abnormalities caused by disruption of these transcription factors in one, can be recovered by substitution of the factor(s) from the other. Such studies have provided strong evidence that there exists a conserved genetic programme for insect and mammalian brain development, which presumably arose in a more primitive common ancestor [ (PUBMED:10199636) (PUBMED:10440864) ]. Two vertebrate orthodenticle-related transcription factors have been indentified, Otx1 and Otx2, which have sizes of 355 and 289 residues respectively. They contain a bicoid-like homeodomain, which features a conserved lysine residue at position 9 of the DNA recognition helix, which is thought to confer high-affinity binding to TAATCC/T elements on DNA [ (PUBMED:10375352) ]. Otd-like transcription factors have also been found in zebrafish and certain lamprey species. This entry represents a conserved region found in the C-terminal region of these proteins. |
GO process: | multicellular organism development (GO:0007275) |
GO component: | nucleus (GO:0005634) |
GO function: | DNA-binding transcription factor activity (GO:0003700) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TF_Otx