The domain within your query sequence starts at position 66 and ends at position 126; the E-value for the TGS domain shown below is 5.6e-14.

IKISLPEGQKVDAVAWNTTPYQLAHQISVTLADTAVAAEVNGELYDLDRPLETDCHLRFL
T

TGS

TGS
PFAM accession number:PF02824
Interpro abstract (IPR004095):

The TGS domain is present in a number of enzymes, for example, in threonyl-tRNA synthetase (ThrRS), GTPase, and guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase (SpoT) [(PUBMED:10447505)]. The TGS domain is also present at the amino terminus of the uridine kinase from the spirochaete Treponema pallidum (but not any other organism, including the related spirochaete Borrelia burgdorferi).

TGS is a small domain that consists of ~50 amino acid residues and is predicted to possess a predominantly beta-sheet structure. There is no direct information on the functions of the TGS domain, but its presence in two types of regulatory proteins (the GTPases and guanosine polyphosphate phosphohydrolases/synthetases) suggests a ligand (most likely nucleotide)-binding, regulatory role [(PUBMED:10447505)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TGS