The domain within your query sequence starts at position 11 and ends at position 604; the E-value for the TH1 domain shown below is 6.5e-276.

GEDYFGNASEWGEEADGGQHQEDDSGEGEDDAEVQQECLHKFSTRDYIMEPSIFNTLKRY
FQAGGSPENVIQLLSENYTAVAQTVNLLAEWLIQTGVEPVQVQETVENHLKSLLIKHFDP
RKADSIFTEEGETPAWLEQMIAHTTWRDLFYKLAEAHPDCLMLNFTVKVAGAPGADPWLC
VVWQLISDAGYQGEITSVSTACQQLEVFSRVLRTSLATILDGGEENLEKNLPEFAKMVCH
GEHTYLFAQAMMSVLAQEEQGGSAVRRVAQEVQRFAQEKGHDASQITLALGTAASYPRAC
QALGAMLSRGALNPADITVLFKMFTSMDPPPVELIRVPAFLDLFMQSLFKPGAKINQDHK
HKYIHILAYAASVVETWKKNKRVSIGKDELKSTSKAIETVHNLCCNENKGASELVAELST
LYQCIRFPVVAMGVLKWVDWTVSEPRYFQLQTDHTPVHLALLDEISTCHQLLHPQVLQLL
VKLFETEHSQLDVMEQLELKKTLLDRMVHLLSRGYVLPVVSYIRKCLEKLDTDISLIRYF
VTEVLDVIAPPYTSDFVQLFLPILENDSIAGTIKAEGEHDPVTEFIAHCKSNFI

TH1

TH1
PFAM accession number:PF04858
Interpro abstract (IPR006942): TH1 is a highly conserved but uncharacterised metazoan protein. No homologue has been identified in Caenorhabditis elegans [(PUBMED:11030415)]. TH1 binds specifically to A-Raf kinase [(PUBMED:11952167)].
GO process:negative regulation of transcription, DNA-templated (GO:0045892)
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TH1