The domain within your query sequence starts at position 60 and ends at position 124; the E-value for the THEG domain shown below is 1.5e-14.
WGNQDPIRPVSEAALKAKLSKRIEDLAQPRLVSRHYVPNRLVLANRQGASSGLRKENKLR ARLSR
THEG |
---|
PFAM accession number: | PF14912 |
---|---|
Interpro abstract (IPR006623): | Repeats found in the Mus musculus (Mouse) and Homo sapiens (Human) THEG (testicular haploid expressed gene) proteins and several Drosophila melanogaster (Fruit fly) proteins [ (PUBMED:11173852) ]. This repeat is the only conserved part of the THEG proteins from vertebrate spermatids. Both human and mouse THEG are specifically expressed in the nucleus of haploid male germ cells and are involved in the regulation of nuclear functions [ (PUBMED:11173852) (PUBMED:10330110) ]. Although the differential gene expression of THEG in spermatid-Sertoli cell co-culture supports the relevance of germ cell-Sertoli cell interaction for gene regulation during spermatogenesis, THEG was not found to be essential for spermatogenesis in mice [ (PUBMED:12748127) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry THEG