The domain within your query sequence starts at position 6 and ends at position 125; the E-value for the THF_DHG_CYH domain shown below is 1.7e-36.

ILNGKLVSAQIRDRLKNQVTRMQEQVPGFTPGLAILQVGDRDDSNLYINVKLKAAEEIGI
KATHIKLPRTSTESEVLKYVISLNEDASVHGFIVQLPLDSENSINTEAVINAIAPEKDVD

THF_DHG_CYH

THF_DHG_CYH
PFAM accession number:PF00763
Interpro abstract (IPR020630): Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF). Various reactions generate one-carbon derivatives of THF, which can be interconverted between different oxidation states by methylene-THF dehydrogenase (EC 1.5.1.5), methenyl-THF cyclohydrolase (EC 3.5.4.9) and formyl-THF synthetase (EC 6.3.4.3) [(PUBMED:2541774), (PUBMED:8485162)]. The dehydrogenase and cyclohydrolase activities are expressed by a variety of multifunctional enzymes, including the tri-functional eukaryotic C1-tetrahydrofolate synthase [(PUBMED:2541774)]; a bifunctional eukaryotic mitochondrial protein; and the bifunctional Escherichia coli folD protein [(PUBMED:2541774), (PUBMED:8485162)]. Methylene-tetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclo-hydrolase share an overlapping active site [(PUBMED:2541774)], and as such are usually located together in proteins, acting in tandem on the carbon-nitrogen bonds of substrates other than peptide bonds.

This entry represents the N-terminal catalytic domain of these enzymes.

GO process:oxidation-reduction process (GO:0055114)
GO function:methylenetetrahydrofolate dehydrogenase (NADP+) activity (GO:0004488)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry THF_DHG_CYH