The domain within your query sequence starts at position 10 and ends at position 424; the E-value for the THOC2_N domain shown below is 3.5e-65.

VPAEWIKTWEKSGRGEFLRLCRILSESKSRDTFAWRDFQQALYELSYHVIKGTLKPEQAS
NVLNDISEFREDIPFILADIFCILDIETNCLEEKSKRDHFTQLILACLYLVSDTVLKERL
DPETLGSLGLIKQSQQFNQKSVKIKTKLFYKQQKFNLLREENEGYAKLIVELGQDLSGNI
TSDLILEILKSLIGCFNLDPNRVLDIILEVFECRPEHHDFFISLLEAYMSMCEPHTLCHI
LGFKFKFYQEPNGETPSSLYRAAAVLLQFNLIDLDDLYVHLLPADSCIVSEYKREIVEAK
QIVKKLTMVVLPSEKSDEREKEKKKDDKVEKAPDNQKLGLLEALLIIGDWKHAQSIMDHM
PPYYATSHKVIALAICNLIHITIEPIYRRVGVPKGAKGSPVNALQNKKAPKQAES

THOC2_N

THOC2_N
PFAM accession number:PF16134
Interpro abstract (IPR032302):

This entry represents the N terminus of THO complex subunit 2 (THO2, THOC2) [(PUBMED:15998806), (PUBMED:11060033)].

THO/TREX, a nuclear protein complex conserved from yeast to humans, plays an important role in mRNP biogenesis connecting transcription elongation, mRNA export and preventing genetic instability. THO could be relevant to different mRNA processing steps, including the 3'-end formation, transcript release and export [(PUBMED:22207203)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry THOC2_N