The domain within your query sequence starts at position 7 and ends at position 139; the E-value for the THOC7 domain shown below is 9.3e-43.

DEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGK
TLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVI
QHHPDRHETLKEL

THOC7

 THOC7
PFAM accession number:PF05615
Interpro abstract (IPR008501):

The THO complex (THOC) is involved in transcription elongation and mRNA export from the nucleus [ (PUBMED:15133499) ]. This entry represents the subunit THOC7, which is found in higher eukaryotes, and the non-homologous subunit Mft1 found in yeast.

Mft1 is a component the THO subcomplex of the TREX complex, which operates in coupling transcription elongation to mRNA export [ (PUBMED:12093753) ]. The THO complex is recruited to transcribed genes and moves along the gene with the elongating polymerase during transcription [ (PUBMED:12871933) ]. THO is important for stabilising nascent RNA in the RNA polymerase II elongation complex by preventing formation of DNA:RNA hybrids behind the elongating polymerase [ (PUBMED:14527416) ]. It functions in cotranscriptional formation of an export-competent messenger ribonucleoprotein particle (mRNP) by facilitating the loading of ATP-dependent RNA helicase Sub2 and the mRNA export factor Yra1 along the nascent mRNA [ (PUBMED:15192704) ].

In mammals, the THO complex specifically associates with spliced mRNA and not with unspliced pre-mRNA. It is recruited to spliced mRNAs by a transcription-independent mechanism. It binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export [ (PUBMED:15998806) (PUBMED:17190602) ].

GO process:mRNA processing (GO:0006397)
GO component:THO complex part of transcription export complex (GO:0000445)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry THOC7