The domain within your query sequence starts at position 123 and ends at position 709; the E-value for the THRAP3_BCLAF1 domain shown below is 8.7e-163.

GRSRSRSPKRRSPSPRSRSHSRNSDKSSSDRSRRSSSSRSSSNHSRVESSKRKSTKEKKS
SSKDSRPSQAAGDNQGDEAKEQTFSGGTSQDIKGSESSKPWPDATTYGAGSASRASVSDL
SPRERSPALKSPLQSVVVRRRSPRPSPVPKPSPPLSNASQMGSSMSGGAGYQSGAHQGQF
DHGSGSLSPSKKSPVGKSPPATGSAYGSSQKEESAASGGAAYSKRYLEEQKTENGKDKEQ
KQTNADKEKLKEKGGFSDADVKMKSDPFAPKTDSEKPFRGSQSPKRYKLRDDFEKKMADF
HKEELDEHDKDKSKGRKEPEFDDEPKFMSKVIAGASKNQEEEKSGKWESLHTGKEKQRKA
EEMEDEPFTERSRKEERGGSKRSESGHRGFVPEKNFRVTAYKAVQEKSSSPPPRKTSESR
DKLGSKGDFSSGKSSFSITREAQVNVRMDSFDEDLARPSGLLAQERKLCRDLVHSNKKEQ
EFRSIFQHIQSAQSQRSPSELFAQHIVTIVHHVKEHHFGSSGMTLHERFTKYLKRGNEQE
AAKNKKSPEIHRRIDISPSTFRKHGLTHEELKSPREPGYKVNCCFDQ

THRAP3_BCLAF1

THRAP3_BCLAF1
PFAM accession number:PF15440
Interpro abstract (IPR029199):

This family includes thyroid hormone receptor-associated protein 3 (THRAP3), which is a spliceosome component and a subunit of the TRAP complex which plays a role in pre-mRNA splicing and mRNA decay [(PUBMED:20123736)]. It also includes the transcriptional repressor Bcl-2-associated transcription factor 1 (BCLAF1) [(PUBMED:10330179)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry THRAP3_BCLAF1