The domain within your query sequence starts at position 146 and ends at position 255; the E-value for the TIG domain shown below is 9.4e-18.

PTIRSITPLSGTPGTLITIKGRLFTDVYGSNTALSSNGRNVRILRIYIGGMPCELLIPHS
DDLYGLKLDHANGDTGSVTCKTTGTYIGHHNVSFILDSDYGRSFPEKMTY

TIG

TIG
PFAM accession number:PF01833
Interpro abstract (IPR002909): The IPT (Ig-like, plexins, transcription factors) domain has an immunoglobulin like fold [(PUBMED:10390613)]. These domains are found in cell surface receptors such as Met and Ron as well as in intracellular transcription factors where it is involved in DNA binding. The Ron tyrosine kinase receptor shares with the members of its subfamily (Met and Sea) a unique functional feature: the control of cell dissociation, motility, and invasion of extracellular matrices (scattering) [(PUBMED:8816464)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TIG