The domain within your query sequence starts at position 1 and ends at position 123; the E-value for the TIMELESS domain shown below is 3.6e-47.
MVNLTQPALLCFGSVPKDSSVRHHFLQVLTYLQAYKEAFASEKAFGVLSETLYELLQLGW EDRQEEDNLLIERILLLVRNILHVPANLEQEKSIDDDASIHDRLLWAIHLSGMDDLLLFL SS
TIMELESS |
![]() |
---|
PFAM accession number: | PF04821 |
---|---|
Interpro abstract (IPR006906): | The timeless gene in Drosophila melanogaster (Fruit fly) and its homologues in a number of other insects and mammals (including human) are involved in circadian rhythm control [ (PUBMED:11710984) ]. This family includes related proteins from a number of fungal species and from Arabidopsis thaliana. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry TIMELESS