The domain within your query sequence starts at position 1040 and ends at position 1203; the E-value for the TIP120 domain shown below is 1.9e-68.

LIRDLLDSVLPHLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDSCLDR
LDIFEFLNHVEDGLKDHYDIKMLTFLMLVRLSTLCPSAVLQRLDRLVEPLRATCTTKVKA
NSVKQEFEKQDELKRSAMRAVAALLTIPEAEKSPLMSEFQSQIS

TIP120

TIP120
PFAM accession number:PF08623
Interpro abstract (IPR013932):

TIP120 (also known as cullin-associated and neddylation-dissociated protein 1) is a TATA binding protein interacting protein that enhances transcription [(PUBMED:10567521)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry TIP120